MyLaserTools.com
Minerals and Fossils
White crystals in dark rock - Exotic Mineralogy, Volume 1 - 1811
SVGPrint

Low-resolution preview · Full detail in the SVG

White crystals in dark rock - Exotic Mineralogy, Volume 1 - 1811

Printable colour vector

Full detail for your next creation

Unlock once, create again and again. Yours to redownload and use in the editor, with no more sparks to spend.

16 colour layers

Format
SVG, one filled path per colour
Best for
UV printing
License
Public domain
Credit required
No
From the pages of
James Sowerby, Exotic Mineralogy, Volume 1 (1811)
mineralmineralogyrockspecimencrystalwhitemineralsgeologyhand-colouredsquarebold-lineintricate

Printing this file

Each colour in the original plate is a separate filled path, so the file prints as flat colour rather than as a photograph. Open it in the Design Editor to scale it, recolour a layer, or drop it onto a blank, then send it to a UV printer. It is a print file rather than a cut file: for cutting or engraving, use the single-colour version of the library.

More minerals and fossils prints

See all minerals and fossils
  • Brown stalactite columns - British Mineralogy, Volume 1 - 1804
  • Cut cylindrical mineral specimen - British Mineralogy, Volume 1 - 1804
  • Dark red crystals in brown rock - British Mineralogy, Volume 1 - 1804
  • Green botryoidal copper mineral - British Mineralogy, Volume 1 - 1804
  • Fossil shells in pale stone - British Mineralogy, Volume 1 - 1804
  • White veined brown rock - British Mineralogy, Volume 1 - 1804
  • Spar cubes and orange rhomb - British Mineralogy, Volume 1 - 1804
  • Cut oval stones with netted interiors - British Mineralogy, Volume 1 - 1804