MyLaserTools.com
Machines and Engines
Stack of wheels on an upright frame 02 - Les Raisons des Forces Mouvantes - 1615
SVGPrint

Low-resolution preview · Full detail in the SVG

Stack of wheels on an upright frame 02 - Les Raisons des Forces Mouvantes - 1615

Printable colour vector

Full detail for your next creation

Unlock once, create again and again. Yours to redownload and use in the editor, with no more sparks to spend.

1 colour layer

Format
SVG, one filled path per colour
Best for
UV printing
License
Public domain
Credit required
No
From the pages of
Salomon de Caus, Les Raisons des Forces Mouvantes
machineinventionengravedwheelmechanismframemachineshydraulicfountaingrottoautomatonportrait

Printing this file

Each colour in the original plate is a separate filled path, so the file prints as flat colour rather than as a photograph. Open it in the Design Editor to scale it, recolour a layer, or drop it onto a blank, then send it to a UV printer. It is a print file rather than a cut file: for cutting or engraving, use the single-colour version of the library.

More machines and engines prints

See all machines and engines
  • Machine 07 - Illustrated Catalogue of Carriages - 1860
  • Grocery store advertisement - Illustrated Catalogue of Carriages - 1860
  • Steam heating radiator - Illustrated Catalogue of Carriages - 1860
  • Curled hair factory advertisement - Illustrated Catalogue of Carriages - 1860
  • Machine 10 - Illustrated Catalogue of Carriages - 1860
  • Machine 06 - Illustrated Catalogue of Carriages - 1860
  • Coach carriage - Illustrated Catalogue of Carriages - 1860
  • Machine 11 - Illustrated Catalogue of Carriages - 1860