MyLaserTools.com
Ornament Plates
Sphinx and pharaoh head with lotus ornaments - The Grammar of the Lotus - 1891
SVGPrint

Low-resolution preview · Full detail in the SVG

Sphinx and pharaoh head with lotus ornaments - The Grammar of the Lotus - 1891

Printable colour vector

Full detail for your next creation

Unlock once, create again and again. Yours to redownload and use in the editor, with no more sparks to spend.

4 colour layers

Format
SVG, one filled path per colour
Best for
UV printing
License
Public domain
Credit required
No
From the pages of
William H. Goodyear, The Grammar of the Lotus
sphinxpharaohnemeswingedlotuspalmettereliefegyptian-revivalornamentclassicegyptiangreek

Printing this file

Each colour in the original plate is a separate filled path, so the file prints as flat colour rather than as a photograph. Open it in the Design Editor to scale it, recolour a layer, or drop it onto a blank, then send it to a UV printer. It is a print file rather than a cut file: for cutting or engraving, use the single-colour version of the library.

More ornament plates prints

See all ornament plates
  • Band and column plate
  • Painted chevron and lotus bands - The Grammar of Ornament - 1856
  • Lotus and palmette bands in colour - The Grammar of Ornament - 1856
  • Border band sampler plate 02
  • Painted fan and box lids - Polychromatic Ornament - 1877
  • Painted pilaster strips and bands - The Grammar of Ornament - 1856
  • Egyptian winged scarab and goddess panel - Der Ornamentenschatz - 1887
  • Egyptian winged sun doorway with lotus capitals - Der Ornamentenschatz - 1887