
SVGPrint
Low-resolution preview · Full detail in the SVG
Small banded whelks - Conchology, or the Natural History of Shells - 1811
Printable colour vector
Full detail for your next creation
Unlock once, create again and again. Yours to redownload and use in the editor, with no more sparks to spend.
8 colour layers
- Format
- SVG, one filled path per colour
- Best for
- UV printing
- License
- Public domain
- Credit required
- No
- From the pages of
- George Perry, Conchology, or the Natural History of Shells
shellconchologyengravedscientificwhelkshellsmollusccolouredplateperry-conchologyperry1811
Printing this file
Each colour in the original plate is a separate filled path, so the file prints as flat colour rather than as a photograph. Open it in the Design Editor to scale it, recolour a layer, or drop it onto a blank, then send it to a UV printer. It is a print file rather than a cut file: for cutting or engraving, use the single-colour version of the library.
More shells prints
See all shellsEmail Updates
Keep up with MyLaserTools.
Email me about new tools, product updates, tutorials, and occasional MyLaserTools offers. Unsubscribe at any time.
Tag us on Instagram
Share what you made with @mylasertools
Join our Facebook Group
Share creations, ask questions, get inspired
Contact & Follow
Resources
YXE Creations Craft Hub Inc
© 2026 MyLaserTools.com. All rights reserved.













