MyLaserTools.com
Figures in Colour
Draped figure reclining on a carved base - Galerie Mythologique, Volume 1 - 1811
SVGPrint

Low-resolution preview · Full detail in the SVG

Draped figure reclining on a carved base - Galerie Mythologique, Volume 1 - 1811

Printable colour vector

Full detail for your next creation

Unlock once, create again and again. Yours to redownload and use in the editor, with no more sparks to spend.

3 colour layers

Format
SVG, one filled path per colour
Best for
UV printing
License
Public domain
Credit required
No
From the pages of
Aubin-Louis Millin, Galerie Mythologique, Volume 1 (1811)
mythologyclassicalgreekromanengravingrecliningdraperyrelieffiguresstatuegodantique

Printing this file

Each colour in the original plate is a separate filled path, so the file prints as flat colour rather than as a photograph. Open it in the Design Editor to scale it, recolour a layer, or drop it onto a blank, then send it to a UV printer. It is a print file rather than a cut file: for cutting or engraving, use the single-colour version of the library.

More figures in colour prints

See all figures in colour
  • Bride and attendants - Fashion Plates - 1880
  • Rider in a park - Dresses and Decorations of the Middle Ages - 1843
  • Woman seated on a rock 01 - Peterson's Magazine - 1848
  • Young woman in a cap - Peterson's Magazine - 1848
  • Portrait of a bearded man - Coloured Figures of the Eggs of British Birds - 1896
  • Bearded god seated with an eagle - Galerie Mythologique, Volume 1 - 1811
  • Nude god with a spear and an eagle - Galerie Mythologique, Volume 1 - 1811
  • Figure at a garden gate - History of British Birds, Volume 2 - 1804