MyLaserTools.com
Shells
Banded spire shell - Conchology, or the Natural History of Shells - 1811
SVGPrint

Low-resolution preview · Full detail in the SVG

Banded spire shell - Conchology, or the Natural History of Shells - 1811

Printable colour vector

Full detail for your next creation

Unlock once, create again and again. Yours to redownload and use in the editor, with no more sparks to spend.

8 colour layers

Format
SVG, one filled path per colour
Best for
UV printing
License
Public domain
Credit required
No
From the pages of
George Perry, Conchology, or the Natural History of Shells
shellconchologyengravedscientificspiresea-snailshellsmollusccolouredplatetall-stripfine-line

Printing this file

Each colour in the original plate is a separate filled path, so the file prints as flat colour rather than as a photograph. Open it in the Design Editor to scale it, recolour a layer, or drop it onto a blank, then send it to a UV printer. It is a print file rather than a cut file: for cutting or engraving, use the single-colour version of the library.

More shells prints

See all shells
  • Large brown banded shell - Zoological Illustrations, Volume 1 - 1820
  • Knobbed fossil shell - The Mineral Conchology of Great Britain, Volume 1 - 1812
  • Ribbed fossil ammonites - The Mineral Conchology of Great Britain, Volume 1 - 1812
  • Ribbed ammonite with broken whorl - The Mineral Conchology of Great Britain, Volume 1 - 1812
  • Ammonite with mineral filled chambers - The Mineral Conchology of Great Britain, Volume 1 - 1812
  • Dark crusted ammonite - The Mineral Conchology of Great Britain, Volume 1 - 1812
  • Clam shell group 03
  • Clam shell group 05