Knobbed spindle shell 02 - Conchology, or the Natural History of Shells - 1811

Printable colour vector

This design is too detailed for Layers / 3D on this device. Open it on a computer to build it.

Every colour as its own shape, ready to print or recolour.

Full detail for your next creation

Unlock once, create again and again. Yours to redownload and use in the editor, with no more sparks to spend.

8 colours

Format: SVG, each colour its own shape
Best for: UV printing
Also makes: Inlay and layered art, to laser cut or 3D print
License: Public domain
Credit required: No
From the pages of: George Perry, Conchology, or the Natural History of Shells

shellconchologyengravedscientificspindleshellsmollusccolouredplateperry-conchologyperry1811

Printing this file

Every colour in the original plate is its own shape, so it prints bold and clean, like a screen print. Open it in the Design Editor to resize it, recolour it or place it on a blank, then send it to a UV printer. To cut it in real colours, open the Inlay or Layered tab.